SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI72486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI72486
Domain Number - Region: 416-454
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00115
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI72486
Sequence length 750
Comment (Physcomitrella patens)
Sequence
MFPKTRSQKPTLNQGLEHIGRRGGKVVDYKEAAPSRKTLINSRSNEEFLGGDIRRNLEKA
LGDVGGSELLEELEVEELEIEHVDPEDGVFGDVNLREIGEQDRTLDFVPTVEGFVHEMAT
ERLLALDPLVRPRDLPVAMPAVLLAATIPGNLPKFYSTKDEDPTLHMERYIEILTTSLIG
NEGYYLVWFSGTLHGEAYNWYRDHDEGHFTTWSQLQVAFLNHFRPEVGQSTTLRALGAVR
QQRDEEMANYIRRFDLVCMRYVGGLLNGDTLKKFFIEGFANRSTIKGVLERNPATLEEAK
TVARVVDLIERSYERHWRKEDESIPRFIPINPLSQAVEPSTSSTPPIVDNGAQYYNVMPT
ATRALVPLLALLEPQLERRVEDLEKKIQAGQEGFQDSMMKQIQALTEQMAFMVKNQNSNT
PPPRIESGNHNSGVWCTTCGQNGHSSLQCRVRPQGNLNPQPYQPTQGYGRDRGPQQRQRG
YQGGPQGYGRSGKPRKEYHELCRRWHEPGQCWDDGQPWPCGNCGGNHPTHECRQPDKVIQ
LPPPITNPYENARNNMRDQRRPHGDDQRGLKPPNLYYNYEDFRQNHQPPEGLQTRQGPSS
NQDVRVGEEVLLNGPVPSLAKTTLVIEEHEAPSNLLTHELKKDGGGGHENATLAVITRGQ
AHRQSPIDEEDSDSSESEELLDLVAFEVAAKEAARITREVGAAVGDKRSSEGSDPGKGLE
PGEWEGPDIQEEEFGGLGRTMPTSYQKYDL
Download sequence
Identical sequences A9RZ76
3218.JGI72486 XP_001759485.1.60028 jgi|Phypa1_1|72486|fgenesh1_pg.scaffold_37000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]