SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI72686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI72686
Domain Number - Region: 148-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000244
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI72686
Sequence length 325
Comment (Physcomitrella patens)
Sequence
MATGSPAIPIVVQMDDVINRTTSVAPLPTFRDFFGADPDQHLSQFLIACSYQNPTWNGSV
DAYPRMLDIRANSGANIQRLVNVTSLQAIPSIMTTAYTPYFSYQQQALSVAELSIISTPK
DFSEALLLNLMKKMEEMAVNMAKDKEKRKKPTNTRTNVLYSNCKGHGHLVTECPSPSQMM
DQYQQIQNQGKIEEINQGPQDSLVNRMEYAQAVLTKNHHKGKGPIQHLGDLEAKGQFDLI
METSNPSPVTGLLHSMQPNSVGLSNEVSITESSDPFQTILFSISFQKISCPLKDPLGGLN
SKEAPSAVPILSPERKNILPQGVKL
Download sequence
Identical sequences A9RZS3
jgi|Phypa1_1|72686|fgenesh1_pg.scaffold_38000071 XP_001759581.1.60028 3218.JGI72686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]