SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73030
Domain Number - Region: 105-132
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000107
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73030
Sequence length 132
Comment (Physcomitrella patens)
Sequence
MMIPVQGRYQNPTWNESVDSYPWMLETGTNFNTNIQRPVNVTSLQAIPPNVTTAYAPYFL
YQQQALTMAEIPIMPILKDSNETLLLNLTKKMEEMVVNMAKDKEKRQKPTNTRTNVWCSN
CKGHGHSVTKCP
Download sequence
Identical sequences A9S0P1
jgi|Phypa1_1|73030|fgenesh1_pg.scaffold_39000200 XP_001759845.1.60028 3218.JGI73030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]