SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI73071
Domain Number 1 Region: 276-321
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000968
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73071
Sequence length 338
Comment (Physcomitrella patens)
Sequence
MGSVANSPAYLSKPLTESEEGIEELGTPLDIFPIRDMSNSNKTGSEDRHKSLANKDQFSV
YQNLSFSPHIQPVKLFGDNNSQSGRLGSPKKTFAGDNFYFNKELSGTSASLMTSGGPAVL
IVVQMGAVGDRTTSVVPLPTFRRFPATIASSLERAKVWGECHYNQNLTVGATMILSQGDY
QMKNWNDASESYLGRNDYGIIPHGIVDAVPFQAVPPSSSQSYAPYSTYQKLISTKKLSNA
LVSRDPIESLLLTLMKKMDELIGNLAKDKEKRYKPTNMHPNVWCSNCKGQGHLVTECPSP
PQMTIQCTFCGGKHITTNCWNLRKQQHLSNQIMTQITL
Download sequence
Identical sequences A9S0S6
XP_001760034.1.60028 jgi|Phypa1_1|73071|fgenesh1_pg.scaffold_40000020 3218.JGI73071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]