SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73219
Domain Number - Region: 339-431
Classification Level Classification E-value
Superfamily Acid proteases 0.000257
Family Retroviral protease (retropepsin) 0.055
Further Details:      
 
Domain Number - Region: 46-86
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73219
Sequence length 450
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLVKLEENTSINNSKNVSKQRYVQRCIWCD
DALHIRKDCNEFNNMIWQGIICWKDGKIALKNRKDLLQTNFARESASYGARVDDEISGST
VTSEFWTSTVSTMQEGKLPQEPLLRTAATIRGRTGWEDLIESLSVHAYIAKSQHEALMEE
KRRGNFDDTREGNSSKRQTRGDKAREAASQELPVKDTSASLGEKTKETKDKGKSIAYKLL
SDIEVATDLKGLLEERILNAKVEFTLKEVLGITKRDFHDVIIDSIKRKRQLMGKTRMSHA
IDARIYKDEEEVDIGYNDKEIETLSHYTQKHWARATTEVLVKVGGIEEPIVALVDHGSEI
NLMSKDLYKKQKWPIDMELGWAIRAVNNTRGELYRACPDVKIRIGDVVTEQHFFVQDTTS
YPLILGQPYITVSYYVLSCSRTRRAFGCRR
Download sequence
Identical sequences A9S166
XP_001760017.1.60028 jgi|Phypa1_1|73219|fgenesh1_pg.scaffold_40000168 3218.JGI73219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]