SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73518 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73518
Domain Number - Region: 15-53
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000811
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73518
Sequence length 137
Comment (Physcomitrella patens)
Sequence
MAVNMAKDKEKRQKPTNTRTNDWCSNCKDHSHLVTECTSPSQMMDQCTFCGGKHKTGLTT
GLLANMRPELVRRLNVVPITGLQFRFRLFHPLYCSGNVLLVKRSLKGKNGGESFDIESQF
WIQALTAGANFGSKTED
Download sequence
Identical sequences A9S201
XP_001760353.1.60028 jgi|Phypa1_1|73518|fgenesh1_pg.scaffold_42000076 3218.JGI73518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]