SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73672 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73672
Domain Number - Region: 116-152
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000157
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73672
Sequence length 191
Comment (Physcomitrella patens)
Sequence
MVSASLNRAKVWEECHYDQFLTAKATLISIQDTRTNSSANIHRPINVISLQAIPPNVTTA
YAPYFLYQQQALTTAELQIIPASKDSNEALLLNLMKKMEEMAINMAKDKEKRQKPTNTRT
NTWCSNCKGNGHLITQCPLSSPIMSQCTFCGGKYLTANYWNLQRQQQFSNQTMIPPTHWD
VNQVQLENTFG
Download sequence
Identical sequences A9S2D0
XP_001760580.1.60028 3218.JGI73672 jgi|Phypa1_1|73672|fgenesh1_pg.scaffold_43000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]