SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73735 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73735
Domain Number - Region: 657-749
Classification Level Classification E-value
Superfamily Acid proteases 0.0323
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number - Region: 443-467
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0733
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73735
Sequence length 881
Comment (Physcomitrella patens)
Sequence
MWSRLRGFRFRFRLFRLLCRSRNVLSIKGSLKELAPFVLDLELALAVRAFSSVLTFKRSF
YRKQHSLKWHREQDSLKQNQNPVIKTTLSRPTNSGLILVKSPVIRSGCSSNWIKLVLRVR
LAEARTFQYAPADYDGVTKPSLSVFALELVVAPNIRETYRLGQKGLWRADEGHPYRFMDV
WEEFLVGVLLKDKQHQSNDRKEALATKALQAVVNKIDQFDGKNISRYLRYYVREMELNRV
FEKKMVELFGLATIPEIRDHIISITDCYGNSWEVFSHALKDEYFLEDADHPNKNLQVTEL
LREFERQYSQLPKVEKLILEPNKVDLFLQAADGELQGKLELLLEDKEEDEGLTIKWKNIE
DTVGLLTKREKRKNRSNISKTLQAPKALVRTTPPTMPIVQPSTSLSKKADMGMEEIIRGI
QDLQIKLARLEENTSINNLKNVSKQGYVQRCIWCNDASHTRKDCNEFNNMIQQGIISWKD
GKIALKDREDLLQTNFGKGGMKALVQDYLKEHETVARESASYGARVDDDLGGSTETSEFW
ASAISTMQEGKLSREALLRTAVEFTLKEVLRIAKKEFHDVIIDNIKRKRQLMDKTGINHA
IDARIYEDEEEVDIGYKQPTNEKNGYNQRVRFEDYCDKEMKTLSYYTRKHWTSATTEVLV
KVGDIEEPIVALVDHGCEINLMSKDLYKKQKWPIDMEHGWIIRATNNTWGELYRACPDIK
IWIGDVATEQHFFVQDTTSYPLILGQPYIMATRMETKVLDDGSAYARIRSEDERKAIQFL
TVPPNHEWNRDMLTEKLLPKIVERFKDFGEVLPNMRSELVGQPNAVQLRKYLGLTTGLLA
NMRPKLVGRLNVVPITGVSILFQAVSSFVPFRERPFGKRIF
Download sequence
Identical sequences A9S2J1
3218.JGI73735 XP_001760532.1.60028 jgi|Phypa1_1|73735|fgenesh1_pg.scaffold_43000105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]