SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73736 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73736
Domain Number - Region: 631-723
Classification Level Classification E-value
Superfamily Acid proteases 0.038
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number - Region: 303-327
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0837
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73736
Sequence length 998
Comment (Physcomitrella patens)
Sequence
MEPNKVDLFLQAADGELQGKLELLLEDKEEDEGLTTKWKNVEDASIASMFQAFSLSMQQH
QSNDRKEALATKALQAVVNKIDQFDGRNISSYLRCYVREIELNWVSEKKMVELFGLAMIP
EIRNHITSITDRYGNSWEVFSHALKDEYFLEDAHRVTKKLFQEWIEQPNKNLQVEKLILE
PNKVDLFLQAADGELQGKLELLLEDKEEDEGLTTKWKNIEDTVGLLTKRERRKNRSNISK
TLQAPKAPVRTTPPTMPIVQPSTSLLKKADMGMEEIIRGIQDLQIKLARLEENTSINNLK
NVSKQGYVQRCIWCNDASHTRKDCNEFNNMIQQGIISWKDGKIALKDREDLLQTNFGKGG
MKALVQDYLKEHETVARESASYGARVDDDLGGSTETSEFWASAISTMQEGKLSREALLRT
AVTIRGARGWKDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRQTRGDKARE
TASQEFSVKNTSVSLEEKARETKDKGKSIAYKLLSDIEAATNLKGMLEEHILNTKVEFTL
KEVLRIAKKEFHDVIIDNIKRKRQLMGKTGINHAIDARIYEDEEEVDIGYKQPTNEKNGY
NQRVRFEDYCDKEMKTLSYYTRKHWTSATTEVLVKVGDIEEPIVALVDHGCEINLMSKDL
YKKQKWPIDMEHGWIIRATNNTWGELYRACPDIKIWIGDVATEQHFFVQDTTSYPLILGQ
PYIMATRMETKVLDDGSAYARIRSEDERKAIQFLTVPPNHEWNRDMLTEKLLPKIVERFK
DFGEEVLSQDEGAFDASFIGILENGNIMYKKVDDFKRKERKRLYNIEGELHKLGTLQDDE
RILGIYEENGLEDSLELITSIGLGDNDKIVEIHWREVYTILESFQAPEVTIEMRYKTADK
KVKLITGPLSEDFKEQMGEASKEVSLRDPMSIGHQFTKETFEELKIGSDGSLLPEEITCF
KKMLAKQGRSFAFESYEIGCVDPNIITTMVIFFVPHVP
Download sequence
Identical sequences A9S2J2
XP_001760605.1.60028 3218.JGI73736 jgi|Phypa1_1|73736|fgenesh1_pg.scaffold_43000106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]