SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73767
Domain Number - Region: 514-605
Classification Level Classification E-value
Superfamily Acid proteases 0.00326
Family Retroviral protease (retropepsin) 0.071
Further Details:      
 
Domain Number - Region: 219-260
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0199
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73767
Sequence length 635
Comment (Physcomitrella patens)
Sequence
MELNRISEKKMVELFGLATISEIRVHITSITDRSGNSWEVFLHALKDEYFLEDADCVTKK
LFLEWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQVADGELQGKLELL
FEDKEEDEGLTTKWKNVDDAVELLTKRERKKDRSNIPKTVQAPKAPVHTTPPTMPTVQPS
TSLSKKSDMEMEEIIRGMRDLQIKLARLEENTSTNNSKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIRQEIICSKDGKIALKDREDLLQTNFGKGRMRALIQDYLKEHETEARESASY
GARVDDDLGGSTKTSEFWASTVSTMQEGKLPREALLKTAATIRGATVHAYIAKSQHEALL
EEKRRGNFDDTREGISSKRQTRGDKAREAASLELPVKDTSASLEENTRETKDKGKSIAYK
LLSDIEAATNLKGVLEERILNAKVEFTLKEVLTIAKKEFHDIIIYSIKRKRQLMGETGMS
HAIVAKIYKDEEEVDIDYKQPTNEKNGYNQRVLVKVGDIEEPIVALIDHGSEINLMSKDL
YKKQKWPIDMEHGWAMRAANNTRGELYGACPDVKIRIGDVVTEQHFFIQDTTSYPLILGQ
PYITATRMETKEEDESDLDNEGDEDELGKDVENIL
Download sequence
Identical sequences A9S2M1
jgi|Phypa1_1|73767|fgenesh1_pg.scaffold_43000137 3218.JGI73767 XP_001760548.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]