SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI73783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI73783
Domain Number - Region: 219-257
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0112
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 10-94
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0523
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI73783
Sequence length 407
Comment (Physcomitrella patens)
Sequence
MELNWVSEKKMVELFELVTIPEIRDHITSITDRYGNLWEVFSHALKDEYFLEDADRVTKK
LFLEWIERLNKNLQAIEVLRKFERQYSQLSKVEKLTLDPNKVDLFLQAANRELQGKLELL
LEDKEEDEGLTTKWKNVEDAVGLLTKRGRRKDRSNISKTVQASKAPVRTTPPKMPTVQPS
TSLSKKSDMGMEEIIREMRDLQIKLARLEENTSTNNLKNVSKQEYVQRCIWCDDASHTRK
DCNEFNNMIRQGIICWKDGKVALKDREDLLQTNFSKGRMRALVQDYLKEHETVARENASY
GARVDDEIGGSTETRFWRSTTIKQDYGGTKEEVLSRDEGAFDASFIDILENGNIVYKKID
DFKRKERKILYDIERELCKLGMQQEDESDLDNEGDEDELDNDIENIF
Download sequence
Identical sequences A9S2N6
XP_001760557.1.60028 3218.JGI73783 jgi|Phypa1_1|73783|fgenesh1_pg.scaffold_43000153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]