SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI74059
Domain Number 1 Region: 352-397
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000182
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74059
Sequence length 420
Comment (Physcomitrella patens)
Sequence
MVNKNESIASRKLNQLRERQGRAQGRNLRREEQERNLKRKHRQNWIKPWLQACQRIQTNQ
ESDRLLILQSYVPLEKLPRTLAGNFVNIPMEILRPLTEREGGIEVFGTPLDNFSVRGTAE
TSNRGSADWHELVTNKGNYIVFQNPTFSPASQSTKLFAEKNSKARTAESSVIRIRKSRDY
FKTNFRRTKNSMAARGPAVPIAVQMGTLGDRTTSVAPLPTFRGLPTSLERAKVWEECHYD
QHLTVGTTMIPSQGGYQMTNWNDALESYPGRSDYGRIPQGIVNAVPLQAVLPSSSQSYVP
YSAYQKSIPTKELTNELVSRDPNDSLLLTLTKKMDELVVNLAKDKEKRHKPTNMRPNVWC
SNCKGQGHLVTKCSSPPQMMVLCTFCGRKHITANCWNLRKQQQVGQQTMSQPTSWDVNQI
Download sequence
Identical sequences A9S3F1
jgi|Phypa1_1|74059|fgenesh1_pg.scaffold_45000073 XP_001760934.1.60028 3218.JGI74059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]