SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74073 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74073
Domain Number - Region: 116-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 
Domain Number - Region: 132-186
Classification Level Classification E-value
Superfamily Hepatitis B viral capsid (hbcag) 0.0353
Family Hepatitis B viral capsid (hbcag) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74073
Sequence length 209
Comment (Physcomitrella patens)
Sequence
MNMEDLNEGIEILQQEDESDLDNEGDEDELDKDVILVKLPPEPSERRKDRSNIPKTVQAP
KAPVRTTPQTMPTVQPSTSLSKKVDIGMEEIIRGMRDLQIKLARLEENTSTNNSKNISKQ
GYVQRCIWCDDASHSRKDCNEFNNMIRQGIICWKDEKIALKDRKDLLQTNFGKGGMRALV
QDYLKEHETVARESASYGIRVDDNLGGFP
Download sequence
Identical sequences A9S3G4
jgi|Phypa1_1|74073|fgenesh1_pg.scaffold_45000087 XP_001760943.1.60028 3218.JGI74073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]