SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74075
Domain Number - Region: 83-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00942
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 
Domain Number - Region: 262-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0256
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74075
Sequence length 857
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPFQGTLFSVNGFLKGFLGEVSGGESSKGQGMHMDPSIASLFQ
AFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREMELYRVSEKKMV
ALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYSEDADRVTKKLFQGWIERPNKNL
QATELLREFERQKKDRSHIPKTVQAPKAPVRTTPPTMPTVQPSTSLSKKADMDMEEIIRG
MRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWK
DGKIALKDREDLLQTNFGKGRMRALVQDYLKEHETVVRESASYGARVDDEIGGSTETSEF
SASVVSTMQEGKLPREALLKTAATIRERTGWEDHVESLSVHAYIAKSQHEALMEEKRRGN
FDDTREGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSDIEA
ATNLKGVLEERILNAKVEFTLKEVLGITKKEFHDVIIDSIKRKRQLMSETGMSHAIDARI
CRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKVLDD
GFAYARVRSEDGRKAAQFLTVPLNHERNRDRLREKPLPKIVEGFKDFGEEVLSPDEGAFD
ASFIGILENGNIMYKKVDDFKRKERKRLYDIEGQLRKIENGLEDSLELITSIGLKDNDKI
VEIHSREVYTMLKSFQAPEVTVETRYKTVDKKVKPVAGPLPEDSKEQMGEASKEASLRDP
MSIGHQLTEETLEELKIGSDGSLLPEEITCFKKMLTKQEMNMEDLYEGTEIPQQEDESDM
DNEGNEDELDKDVGDIF
Download sequence
Identical sequences A9S3G7
3218.JGI74075 jgi|Phypa1_1|74075|fgenesh1_pg.scaffold_45000089 XP_001760945.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]