SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74077
Domain Number - Region: 209-248
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00607
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 30-123
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0288
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74077
Sequence length 339
Comment (Physcomitrella patens)
Sequence
MVALFGLATIPEIRDHITSITDRCGNSWEDFLHALKDEYFLEDADYVNKKLFQGWIEWPN
KNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADKELQEKLEPLLEDKEEDEGL
TTKWKNVEDAVGLLTKKERKKDRSNIPKTVQAPKAPVRTTSPTMPTVQPSTSLSKKADMD
MEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIR
QGIICWKDGKIALKDREDLFQTNFGKGRMRALVQDYLKEHETVVRESASYGARVDDEIGR
KVNMEDLNEGTEIPQQEDESDLDNEGDEDELDKDVGDIF
Download sequence
Identical sequences A9S3G9
3218.JGI74077 jgi|Phypa1_1|74077|fgenesh1_pg.scaffold_45000091 XP_001760946.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]