SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74096
Domain Number - Region: 593-675
Classification Level Classification E-value
Superfamily Acid proteases 0.00555
Family Retroviral protease (retropepsin) 0.058
Further Details:      
 
Domain Number - Region: 301-339
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74096
Sequence length 1273
Comment (Physcomitrella patens)
Sequence
MQSNYGKIQVLLWALANLTRRPIGPNYANIQVTTGILPNMGPELVGRLNVDTKTYRLGQK
GVRQAVEGHPYRFTMYSCSRLYSSGQKLIDYLTIGESPYYLLHPDVRRILEQESTYLRCY
VREMELNRVSEKKMVALFGLAMIPEIRDHITSITDRYRNSWEDFTHALKDEYFLEDVDRE
PNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKRKNIEDAVGLLTKKERKKDRSNIPK
TVQAPKAPVRTIPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSK
NVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGG
MRAFIQDYLKEHETVVRESASYGARVEDEIGGSTETTTIRGRTGWEDPVESLSVHAYIAK
SQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTTETKDK
GKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDNIKRKRQL
MGETRMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRARATTKVLVKVGHMEEPIIALV
DNGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDVKIRIGDVATEQHFF
VQDTTSYPLILGQPYIMATRMETNVLDDGSAYARIRSEDGRKAVQFLTRDYGGTKEEVLS
RDEGAFDASFIGILENGSIMYKKVDDFKRKERKRLYDIEGQLRKIGTLQDDERILGVYEE
NGLEDSLELITSIGLGDNDKIVEIHSREVYTMLESFQAPEVTVETRYRTADKKVKPIIGP
LPEDSKEQMGEASKEASLRDPMSIGHQFTKETFGELKIGSDSFLLPEEITCFKKMLAKQD
PITGTSKERCLRQMDLLKSFIFQQSKLIDYLTIGDLHTTFYSKTPRHSRAGKHIIPHREV
ISKVACHRLKRTKQTSPIEGSSEPVPVPPQREQNSLAQNVNTTEVIYEIGESSRPVGPET
DLIRSVVEEENEVPTLLDINQLAFSQGRLPEGIHLKNSLLKCISQIHCKVRALDVDGSGK
LELEARKKVISEQTQRIEEQEWIIQANAKSKLLLEPQIREQQEAWDKKRERMVETHKQEL
FRAYSHSILKLEKAKGQLVMERKKTKLLAQEKLVLSDQYRCETERLKTEIEALNAEVIRL
AEDLVNIGQAQVSTLPVPEVPEERSHFQRQLELRDAQILKLEAQVRELGEYNEDLSAQLR
QEPMEGLEEDEDL
Download sequence
Identical sequences A9S3I7
3218.JGI74096 jgi|Phypa1_1|74096|fgenesh1_pg.scaffold_45000110 XP_001760866.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]