SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74185
Domain Number - Region: 234-272
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0178
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 15-83
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0785
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74185
Sequence length 614
Comment (Physcomitrella patens)
Sequence
MQQQQSNDRKEALATKALQAGVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGL
ATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKKLFLGWIERPNKNLQATE
LLRKFERQYSQLSKNLFLKTKNEGLTTKKKNVEDAVGLLTKKERRKDRSNIPKQVQASKA
PVRTTPPTMPTVQPSTSLSKKTDMGMEEIIRGMRDLQIKLARLEENTSINNSKNISKQGY
VQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIILKDREDLLQTNFGKGGMRALVQD
YLKGHETVARESASYGIRVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGR
TGWEDPVESLSVHAYIAKSQHEALMEEKRRRNFDDTREGNSFKRQTRGDKAREAASQELP
VKDTSASLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIA
KKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEEDDIGYKQPINEKNGYNQRVRFED
SSDKEMKTLSHYTRKHWTRATTEVLVKVGDIEEPIVALVDHGFEINLMSKDLYKKQKWPI
DMEHGWAIRAANNT
Download sequence
Identical sequences A9S3S2
XP_001761067.1.60028 jgi|Phypa1_1|74185|fgenesh1_pg.scaffold_46000027 3218.JGI74185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]