SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74602
Domain Number - Region: 135-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0126
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74602
Sequence length 317
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTIAASLARAKVWEECHYDQLLMVGTTMIPSVGNQVPMTNTMIGSYPRMIAP
SMGNPNSQGLVNATPLQALPPVATYPSPMAYRQPEVLMNATINDSNEALLLNLTKKMEEL
AVHMTKDKEKRHKPSNMRPNVWCNNCKGQRHFDTKCPSPHQKMGQCMYCGGKHNTANCWY
LPRQQTMIQPTVWDVNQVQTGNTGGWNGNRNNRVNRGITGTLGGSNSRSIDKKSAKRQRT
NSNIGEIDTSPGQQTNTKICSIIGRSVTVTTQFDQYIGASTNFTSTNITPIRWTVTPVKG
SNFQGAVATKNRGSTNS
Download sequence
Identical sequences A9S4U3
XP_001761425.1.60028 jgi|Phypa1_1|74602|fgenesh1_pg.scaffold_48000058 3218.JGI74602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]