SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74657
Domain Number - Region: 157-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00209
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74657
Sequence length 233
Comment (Physcomitrella patens)
Sequence
MESSENIFGRDADYINKRLSVTLSNSMTIGGPAVPIAVQMDTFLTASATMIPVQSNYQYL
ALNGSVDSYPQMIETVAHLSAITQGPINVIPLQALSPQVTTAYAPYFPYQTQESTLAEKQ
IIPASKDSNEALLLNLTKKMEEMVVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHLVTEYP
SPSQVLGKCTFCGGKLLITNCWNLQGQQQFNNPTMIPPTPWDVNQVQIRNTFG
Download sequence
Identical sequences A9S4Z4
3218.JGI74657 XP_001761373.1.60028 jgi|Phypa1_1|74657|fgenesh1_pg.scaffold_48000113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]