SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74685
Domain Number - Region: 360-392
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0286
Family Retrovirus zinc finger-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74685
Sequence length 440
Comment (Physcomitrella patens)
Sequence
MVIKNENLTAKRIKQSKDRTERLQGKNLLCNERDRKLKKKHRKNRIKSWLHACRHIQLYP
EDDQPLIFQKYISLKKLPRALVESTANSPANLSKPLTKNVEGIEELSIPLDIFSIENTSD
PNKTGSEDRHKSLANKDQFKVYQNLSFLPHIQPIKLFGDNNSQLGRLGSPKKTFTGGSFY
FNKKLSGTPTSLMTSRGLAVLIAVQMDAMGDRTTNITPLSNFWGLSATIASSLERAKVWE
ECHYDQNLTVGATMIPSQGGYQMTNWNDASGSYLGRNDYCTIPQGIVDVVPLQAIPPSSS
HPYAPYSVYQKSIPTKKLPNVLVSRDLNESLLLTLTKKMDELAVNLAKNKEKRHKPINMR
PNVWCNNFKGQGHLVTECPLLLQMTIQCIFCEGKYITTNYWNLRKQQQLSNQIMLQPTSG
DVNQVQMNNRFGSNRNRANK
Download sequence
Identical sequences A9S522
XP_001761465.1.60028 jgi|Phypa1_1|74685|fgenesh1_pg.scaffold_48000141 3218.JGI74685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]