SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI74733
Domain Number - Region: 219-256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74733
Sequence length 791
Comment (Physcomitrella patens)
Sequence
MELNRISEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKK
LFLKWIERPNKNLQATELLREFERQYSQLSKVEKLTFEPNKVDLFLQAADGELQEKLEPL
LEDKEEDEGLKMKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPVRTTPPTMPIVQPS
TSLSKKADIRMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIRQGIICWKDGKIVLKDIEDFLQTNFGKGEMRALVQDYLKEHETVRQTRGDK
AREAASQELHVKDTSASLGEKTTETKDKSKSIAYKLLSDIEAATNLKGVLEERILNAKVE
FTLKEVLEIAKKEFHDVIIDSIKRKRICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDK
EMETLSHYTRKHWAGTTTEVLVKVGDIEEPIVTLVDHGTEINLMSKDLYKKQKWPIDMEH
GWAIRAANNTRGELYGACPDVKIRIGDVATKQHFFVQDTTSYPLILGQPYITATRMETKV
LDHGSAYARRDYGGTKEEVLSRDEGAFDASFIGILENGNIMYKKVDDFQRKERKRLYDIK
GQLRKIGILQDDEKILGVCDENGLEDSLELITSIGLGDNDKIVEIHSREVYTMLESFQAP
EVTVETRYKTADKKVKPGPLPEDSKEQMGEASKEASLRDPMSIGHQFTEETFEELKIGSD
GSLLPEEITCFKKMLAKQGRSFAFESHEIGCVDPNIITPMVTYIVPHEKDESDMDNEGDE
DEKDKDVGDIF
Download sequence
Identical sequences A9S565
3218.JGI74733 XP_001761487.1.60028 jgi|Phypa1_1|74733|fgenesh1_pg.scaffold_49000028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]