SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI74833 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI74833
Domain Number 1 Region: 50-82
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000293
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI74833
Sequence length 223
Comment (Physcomitrella patens)
Sequence
MTPYFTSPTYQQSELFTNAAVKDPNEALLLNLTKKMEELAVNLAKDKEKRYNPSNMKSYV
WCNNCKGQGHFDTECPSPKQTGVQYEQIQSQGKMEDLNQGPQDSPIHQVEVVQAVLIRSQ
EKGKGPIQHFGELEAKDQLDLITGTSNPGPDMGPLLSIRLESVVHSNEIPITKASILCQG
VPFSIQFQETSFPLKDPLKGVNSKEPISTQLGEQSYPLKETIL
Download sequence
Identical sequences A9S5G1
3218.JGI74833 XP_001761535.1.60028 jgi|Phypa1_1|74833|fgenesh1_pg.scaffold_49000128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]