SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI75014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI75014
Domain Number 1 Region: 151-195
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000523
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI75014
Sequence length 308
Comment (Physcomitrella patens)
Sequence
MGEGKKMPDCESCEPGAITGSTANSPTNLSKPLMENEEGLEKLGTPVGIFSIGNTSNPNK
TGSEDRHKSLANKDQFKGIVDAVPLQAVPLSSSHPYAPYSVYQKSIPTKELPNALVSRDP
NESLLLTLTKEMDELAMNLVKDKEKRHKSTNMHPNVWCSNCKGQGHLVTKCPSPPQMTVQ
CTFCGGKHITTKCWNLRKQQQLYSQIMTQSTSWDVNQQMQISQPTEDKGPVQQDSPVHRI
EVVNTVLTRGQQEDKNLIQDMDEPIVGEQVAPSMGLNEPISILGRIPILRPQHTEEPNSV
PRANLSGP
Download sequence
Identical sequences A9S5Y4
jgi|Phypa1_1|75014|fgenesh1_pg.scaffold_50000129 3218.JGI75014 XP_001761776.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]