SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI75076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI75076
Domain Number 1 Region: 108-155
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000241
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 
Domain Number 2 Region: 351-398
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000241
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI75076
Sequence length 489
Comment (Physcomitrella patens)
Sequence
MIPVQSNYQYPALNGSVGSYPQMIETVVQSSANTQGPVNVTPLQALPPQVTTAYAPYFPY
QTHESTLAEKQIISASKDSNEALLLNLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNC
QGHGHLVTECPSPSQVLGKCTFCGGKHLTANCWNLQRQQQFSNPTMIPPTPWDVNQVQTG
NTFGWHGNRSNRQNRAVNHFQNSTYSEGFVSNPRNYVKKIRQSRERIERSQARNLLRNEQ
QRKLKRNHRQSWIKPWLHACRHIRAYPEANRHLIFQKYIPLEKLPRALAENLINRPGFLL
RPLTESGGITEELGTPLASKDSNEALLLNLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWC
SNCQGHGHLVTECPSPSQVLGKCTFCGGKHLTANCWNLQRQQQFSNPTMIPPTPWDVNQV
QTGNTFGWHGNRSNRQNRAVNHFQNSTYSEGFVSNPRNYDLESRKNGGNKSRTSRLSSKS
GGMCPYRSY
Download sequence
Identical sequences A9S643
3218.JGI75076 XP_001761897.1.60028 jgi|Phypa1_1|75076|fgenesh1_pg.scaffold_51000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]