SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI75082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI75082
Domain Number - Region: 31-70
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0144
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI75082
Sequence length 526
Comment (Physcomitrella patens)
Sequence
MGMEEIIREMRDLQIKLTRLEENTSTNNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNM
IRQGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEYETTARRSASYGATIDDEI
GRSTETSWEDPVESLSIHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRQTRRDKAREAT
SQELPVKDTSASLGEKTKEIKDKGKSIAYKLLSHIEAATNLKGVLEERILNAKVEFTLKE
VLGIAKKEFHDVIIDSIKRKRCQNSDWDVATEQHFFIQNTTSYLLILGQPYITATWIETK
VLDDGSTCARVRSEDGRKAVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFEELGTLQDD
ERILGVYEENGLEDSLELITSIGLGDNDKIVEIHLREVYTILESFQAPEVTLETRYKTAD
KNVKPVVGPLPKDSKEQMGEASKEASLRDPMSIGHQFTKETFEELKIDSDGLTMGLSQSD
AKDQFDPITRTSRSYYEPLSQSETRTNLIQLREHPGYYGHLVQYET
Download sequence
Identical sequences A9S649
XP_001761816.1.60028 jgi|Phypa1_1|75082|fgenesh1_pg.scaffold_51000053 3218.JGI75082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]