SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI75232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI75232
Domain Number - Region: 182-220
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 449-532
Classification Level Classification E-value
Superfamily Acid proteases 0.0422
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI75232
Sequence length 921
Comment (Physcomitrella patens)
Sequence
MIERKLWQPKYCKQWSIKIPEIRDHITSITDRYGNSWEDFSHALKDEYFLEDAHRVTKKL
FLGWIERPNKNLQATELLRKFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLL
EDKEEDEGLTTKLKNIEVRIQPWTSLSKKADMDMEEIIRGMRDLQIKLARLEENTSINNS
KNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKE
RMRALVQDYLKEHETVARESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLR
TAATIRASQELPVKDTSASLGEKTTETKDKGKSIAYKLLCDIEAATNLKGVLKECILNAK
VEFTLKEVLGIVKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEEEQVRFEDSSDK
EIETLSHYTRKHWARATTEVLVKVADIDELIVALVDHGSEINLMSKDLYKKQKWPIDMEH
GWVIRTTNNTRGELYGACQDVKIRIRDVATEQHFFVQDTTSYPLILGQPYITATWMETKV
LDNGFAYARVRSEDGRKAIQFLTVPPNHERNRDRLWEKPLPKIVEGFKDFEDEVLSRDEG
AFDASFIGILENGNIMYKKVDDFKRKERKRLYNIEGQLRKIGALQDDERIVGVYEENGLE
DSLELITSIGLGDNDKIVEIHSREVYTMLESFQAPKATVETRYKTADKKVKPVARPLPKD
SKEQMGEASKEASLRDPMSIGHQFIEETFNWTYRLGQKGLRQAVEEHPYRFTKLPRALAG
SAANSSANLSKLLTKNEEGTEELGTPLGIFSIRNTSNPNKTGTEDRHKSLVNNDPFRVYQ
NLLFLPHIQPIKLFGDNNSQSERRRSPKKTFTRDNFYFNKKLSGILASLMTSGAPTVSIA
VQMSALGDRTTSIMPLPTFWS
Download sequence
Identical sequences A9S6J0
jgi|Phypa1_1|75232|fgenesh1_pg.scaffold_52000014 3218.JGI75232 XP_001762039.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]