SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI75450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI75450
Domain Number - Region: 321-415
Classification Level Classification E-value
Superfamily Acid proteases 0.000863
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number - Region: 46-86
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0199
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI75450
Sequence length 734
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIWQGIICWKDGKIALKDRKDLLQTNFGKGGMRALVQDYLKEHETV
VRESASYGARVDDEIGGSTETIHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDK
AREAASQEFPVKDTSASLGENTTETKDKGKSIAYKLLSDIEATTNLKGVLEECILNAKVE
FTLKEVLGIAKKEFHDVIIDSIKRKRQLMGETGMVMLLMQEYVEMKKRLILVTNNQQMKR
MGIISDHYTRKHWARANTEVLVKVGDIEEPIVALVDYGSEINLMSKDLYKKQKWPIDMEH
RWTIRAANNTRGELYGAYPDIKIRIGDVATEQHFFVQDTTSYPLIIGQPYITATRMETKV
LDDGSAYARVRSEDGRKAVQFLTVPPNHERNRDRLREKPLPKIVEGIKDFGEEVLSRDEG
AFDASFIGILENGNIMYKKVDDFKRKERKRLYDIEGQLRKFGTLQDDERILGVYEENGLE
DSLELITSIGLGDNDKFVEIHSREVYTMLESFQAPEVTVETRYKVADKKVKPVAGPLPED
SKEQMKEASKEASLRDPMSIGHQFTEETFEELKIGSDGSLLPEEITCFKKMLAKQGRSFA
FESHEIGCVDPNIITPMVIFTVPHAVLFSVPFQGTLFSVNGFLKGKNGGESLTARANFGS
KLEVGANSRSKTED
Download sequence
Identical sequences A9S750
XP_001762217.1.60028 jgi|Phypa1_1|75450|fgenesh1_pg.scaffold_53000054 3218.JGI75450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]