SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76157
Domain Number - Region: 247-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0212
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76157
Sequence length 733
Comment (Physcomitrella patens)
Sequence
MWSRLRDSILFQAVLFSMPFQGMLFSVNGFLKGKNGGESLTARANFGSKLEDFWEKFLMG
SLLKDKEDFSHALKDKYFLEDADRVTKKLFLGWIERPNKNLQATELLRDFGRQYSQLSKV
EKLTLEPNKVDLFLQAANGKLKEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKKRRKD
RSNIPKTVQAPKALVCITPPTMPTVQPSTFLSKKEDMDMEEIIRGMRDLQIKLARFEENT
SINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQT
NFGKEGMRALVQDYLKEHETVVQESASYGARVDDEIGGSTETSEFWASAISTMQEGKLPR
EALLRTAATIRGRIGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTR
GDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSNIEAATDLKGVLEERILSA
KVEFTLKEVLKIAKKEFHDVIIDIIKRKRQLMEETRMSHAIDGKICRDEEEVDIGYKQPT
NKKNGYNQLVRFEDSIDKEIETLSHYTRKHWVRAITEVLVKVGDIEEPIVALVNHGSEIN
LMSKDLYKKQKWPIDMEHGWAIRVANNTRDELYGACPDVKIRIGDVATEQHFFVQDTTSY
PLILGQPYITATRMETKVLDDGSAYARIRSKDGRKAVQFLTVPPNHERNRDRLREKPLPK
IVEEFKDFGEVPL
Download sequence
Identical sequences A9S8Z8
XP_001762874.1.60028 jgi|Phypa1_1|76157|fgenesh1_pg.scaffold_57000065 3218.JGI76157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]