SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76214
Domain Number - Region: 184-214
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0188
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76214
Sequence length 541
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFLHALKDEYFLEDADRVEKL
TLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSN
IPKTVQAPKAPVRTTPPTMPTVEPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSIN
NSKNVSKQRYVQRCIWCDDASHTRKDCNEFKNMIRQGIICWKDEKIALKDREDLLQTNFG
KGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREAL
LRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDKNGNIMYKKVDDFKR
KERKRLYDIEGQLRKIGTLQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSREV
YTMLESFQAPEVTVETRYKTANKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSIGHQFT
EETFEELKIGSDGSLLPEEITCFKKMLAKQGRLFAFESHEIGCVDPNIITPMVIFTVPHV
P
Download sequence
Identical sequences A9S951
XP_001762900.1.60028 jgi|Phypa1_1|76214|fgenesh1_pg.scaffold_57000122 3218.JGI76214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]