SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76234 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI76234
Domain Number 1 Region: 139-177
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76234
Sequence length 196
Comment (Physcomitrella patens)
Sequence
MFVKEAQSATIAASLERAKVWEECHYDQHLTVGATMIPSQSGYQMTNWNDASESYPGRSD
YGTIPQGIVNAVLLQAVLPSSSQPYVPYSAYQKPIPTKELTNELVSRDPNESLLLTLTKK
MDELAMNLAKDKEKRHKPTNMRPNVWCSNCKGQGHLVTECSSPPQMMVQCTFCGDANKPT
GGGQRSCSTGLTSTSR
Download sequence
Identical sequences A9S971
3218.JGI76234 jgi|Phypa1_1|76234|fgenesh1_pg.scaffold_57000142 XP_001762911.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]