SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI76339
Domain Number 1 Region: 289-326
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000628
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76339
Sequence length 367
Comment (Physcomitrella patens)
Sequence
MTVRKSYVPLEKLPRALTRNFVNIPVEILRPLTEREGGIEVFGTPLDNFPVGGTPETSNR
GSTDWHELVVNKGNYIIFQNPTFSPASQPIKLFAGNKSKARTAESSVIRVRESRDYFKIN
FRGTENSMAAERPAVPIVVQMGTLGDRTTSVVPLPTFRGLPASLERAKVWEECHYDQHLT
VGATMIPWQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAVLPSSSQPYVPYSAY
QKLIPTKELTNELVSRDPNESLLLTLTKKMDELVVNLAKDKEKRHKPTNMQPNVWCSNCK
GQGHLVTECSSPPQMMVQCTFCGDPNKPTGGGQRSCSTGLTSTSRRGGERSTYQGPTERQ
ESNSGPG
Download sequence
Identical sequences A9S9G9
jgi|Phypa1_1|76339|fgenesh1_pg.scaffold_58000095 XP_001763038.1.60028 3218.JGI76339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]