SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76626 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76626
Domain Number - Region: 325-422
Classification Level Classification E-value
Superfamily Acid proteases 0.00104
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 
Domain Number - Region: 159-198
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0217
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76626
Sequence length 726
Comment (Physcomitrella patens)
Sequence
MAVTADRITKKLFLECIKRPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAA
DGELQGKIELLLEDKEEDEGLTTKWKNVEDAVELLTKREKRSNKQYSENSTSTQSSIQPS
TSLSKKANMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIRQGIICWKDGKIALKNREDLLQTNFGKERMRALVQDYLKEHETAARESASY
GARVDDEIGGSMETSEFWASVVSTIQEGKLPREADEEEVDIGYKQPTNEKNGYNQRVHFE
DYSDKEMETLSHYTRKHWARATTEVLVKVEDIEEPIVALVDHGSEINLMSKDHYKKQKWP
IDMEHGWAIRAANNTRGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYITATR
MEIKVLDDGSAYARVRSEDRRKAVQFLTVLPNHERNRDRLREKPLPKIVEGFKDFREEEV
LSGDVGAFDASFIGILEYGNIMYKKVDDFKRKERKRLYDIEGELRKLGTLQDDERILGVY
EENGLEDSLELITSIGLGDNDKIVEIHSREVYTILESFQAPEVTIETTYKTGDKKVKPVA
GPLPDDSKEKMGKTLKEASLRNPMSIEHQFTKETFEELKIGSDGSLLPEEITCFKKMLAK
QGRSFSFESHEIGCVDPNIITPMVIFTVPHVPWNLRPISVPRQEDKSDLDNEGDEDKLDK
DLENIF
Download sequence
Identical sequences A9SA68
XP_001763323.1.60028 3218.JGI76626 jgi|Phypa1_1|76626|fgenesh1_pg.scaffold_60000009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]