SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI76646
Domain Number 1 Region: 330-361
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000017
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76646
Sequence length 424
Comment (Physcomitrella patens)
Sequence
MVIKNENLTAKRIKQSKERTKRSQARNLLCNERDCKLKKKHQQSWIKPWLHACRHIRSYP
EDDRPLIFQKYIPLKKLPRAFVKSTANSPAYLSKPLMESEEGTEELGTLLDIFSIGDTSD
SNKTSSEDQHKSLVNKDQFRVYQSLSFSPHIQPMKLFGDNNSQSRRPGSPKKTFAGDSFY
FNKELSGTPTSLMASGGPAVSIAVQIGVVGNQTTSFAPLLTFWGLPVRATMIPSQGGYQM
INWNDAPGSYLGRNDYGTILQGIVDAVPLQAIPPSSSHPYAPYFAYQKSIPTKKLPNVLV
SRDPNESLLLTLTKKMDELVVNLTKDKEKRHKPTNMRPNFWCSNCKGQGHLVTECPSPPQ
MTIECTFYEGKHITTNCWNLWKQQLSNQIMTQPTLWDVNQCLPEANKKIRIQFKTWMNQS
QKSK
Download sequence
Identical sequences A9SA88
jgi|Phypa1_1|76646|fgenesh1_pg.scaffold_60000029 XP_001763335.1.60028 3218.JGI76646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]