SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76658 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76658
Domain Number - Region: 182-212
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0366
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76658
Sequence length 622
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATIPEIRDHITSITDRYGNSWEVFLHALKDKYFLKDVDRVTKK
LFLEWIERPNKNLQPTELLREFERQYSQLSKVEKLTLEPNKVDLFLDIKKKRRKDRSNIQ
KTVQAPKAPVRTILPRMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNS
KNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDRKIALKDREDLLQTNFGNG
RMRALVQDYLKEHETTARESASYGARVDDEIGGTTETTTNLKGVLEERILNTKMEFTLKE
VLEIAKKEFHDVIIDSIKRKRQIMDETGMSHAIDARIYRDEEEVDIGYKQPTNEKNGYNQ
RVRFEDFSDKKMETLSHYTRKHWARATTEVLVKVGDIKEPIVALVDHGSEINLMSKDIYK
KQKWPIDMEHGWAIRAANNTWDKLYGACLDVKIWIGDVATEQHFFLKIQHLILLDDGSAY
ARVQSEDGRKVVQFLTVPPNHERNRDRLREKPLPKIVEGFKDFGEEVFLRDEGAFDASFI
GILENGNIMYKKVDDFKRKERKRLYDIEGQLRKLGTLQDDERILGVYEENELEDSLELIT
SIGLGDNDKIVEIHSREVLYHT
Download sequence
Identical sequences A9SA99
XP_001763342.1.60028 3218.JGI76658 jgi|Phypa1_1|76658|fgenesh1_pg.scaffold_60000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]