SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76677 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76677
Domain Number - Region: 262-301
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00916
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 60-124
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.051
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76677
Sequence length 386
Comment (Physcomitrella patens)
Sequence
MENENKNFEGFLGEVSGGESSKGQGMHMDPSIASLFQAFSLSMQQQQSNDRKEALATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLATIPEIRDHITSITDRCG
NSWEDFSHALKDEYFLEDADRVTKKLFLGWIEWPNKNLQATELLKEFERQYSQLSKWKNV
EDAVGLLTKKERRKDRSNILKTVQAPKAPVHTTPPTMPTVQPSTSLSKKADMGMEEIIRG
MRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWK
DGKIALKDREDLLQTNFSKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSTETSEF
WASAVSTMQEGKLPREALLRTAATIR
Download sequence
Identical sequences A9SAB7
jgi|Phypa1_1|76677|fgenesh1_pg.scaffold_60000060 3218.JGI76677 XP_001763269.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]