SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI76993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI76993
Domain Number - Region: 144-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.068
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 
Domain Number - Region: 454-538
Classification Level Classification E-value
Superfamily Acid proteases 0.0844
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI76993
Sequence length 574
Comment (Physcomitrella patens)
Sequence
MKELLDFEVSTCNLKVQAVERKEAMATKALQSVFGLLNQFDRRNISKYLKYYSREMELNK
KVSEAVGILAKREYWRRKVVVRQETRPPLTTISRRQQPEPAIPKDAIDELVKRMKDLQIK
LAKLEEKERLPKSKSVSKLGYIQQCIWCNSMEHLRRECGDFIDILRQGVILWKDGKIMLR
DTCEFLKINFGKGGMKKTLEEHLSQHAMASKEAIIYDIEAIREKEDVFDKHIKIGDLWNH
SIINMNKEKITRQELLNTATIIRNAIGWNDPVDTMSVHAYLAKSQHEALMEVKRGRNEIE
ENPKEPTKKKRAQRIEVNKDKGKSKHVTYKLQSDIEAATDLKGVLKERVLNAKIEFTLQE
ILGIAKREFHEVIIDTTKRKRQLKGQSAVSNALNTILIEEEEHELEEYCINKKRLFDLDE
YKDDDKGPGHYIREHWARATTETLVKMEDLVESVIALIDHGSEINIMSKEVHKRERWPID
INHGLVIRAANNIRGDLYGTYLNVKVKVGDVTTKQIFFVQDTTSYPVILSRPYITAVRME
TKVLDDGSACARIRSQDRKKVVQFLTVLTNHKRN
Download sequence
Identical sequences jgi|Phypa1_1|76993|fgenesh1_pg.scaffold_62000015 3218.JGI76993 XP_001763652.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]