SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI77527 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI77527
Domain Number - Region: 84-104
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0335
Family Retrovirus zinc finger-like domains 0.0072
Further Details:      
 
Domain Number - Region: 127-200
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.051
Family C-terminal domain of PLC-beta 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI77527
Sequence length 217
Comment (Physcomitrella patens)
Sequence
MAASLNRAKVWEECHYDQFLIAGATMILVQAYTPYFPYRQQVLTTTEIPIMPALKDSNET
LLLNLTKKMEEIAINMVKDKEKSNCKGHGHSVTECPSPSQIMGQSVLTRSQQKGKGPIQH
LGNLDAKDQFDLIRGPSNPGPVTGFVPSMRPDSMAQPNEQQQLEAQVRELREYDEDLSAQ
LKQEPMEGLEEDKDLQLEPELVEPELVEPITDTAAIN
Download sequence
Identical sequences A9SCJ1
XP_001764086.1.60028 3218.JGI77527 jgi|Phypa1_1|77527|fgenesh1_pg.scaffold_65000154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]