SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI77592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI77592
Domain Number - Region: 526-615
Classification Level Classification E-value
Superfamily Acid proteases 0.0263
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 
Domain Number - Region: 236-266
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI77592
Sequence length 718
Comment (Physcomitrella patens)
Sequence
MQQQQSNNRKEALATKALQVVVNKIDQFDGRNISRYLRCYHREMELNRVSEKKMVELFRL
ATIPEIRDHITSITDCYGNSWEIFSYALKDEYFLEDADCVTKKLFLEWIEWPNKNLQATE
LLREFERQYCQLSKVEKLTLEPNKVDLFLQATDGELQEKLELLLEDKEEDEGLTTKWKNI
EDAMGLLTKRQRRKDRSNIPKTKVDIGMEEIIRRMRDLQIKLARLEENTSTNNSKNVSKQ
GYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDEKIALKDRKDLLQTNFGKGRIKALV
QDYLKEHETTARESASYGVRVDDDLSGSTKTIHAYIAKSQHEALMEEKRRGNFDDTREGN
SSKRQTRGDKAREAASQELLVKDTSASLKEKTRKTKDEDKSIAYKLLSNIEAATNLKGVL
EERILNAKVEFTLKEVLRIAKKEFHDVIIDSIKRKRQFMGKTGMSHAIDARIYKDEEEVD
IGYKQSTNEKNGYNQQVRFEDYSDKEMENLSHYTRKHWKRATTEVLVKVGDIEEPIVALV
DRGSEINLMSKDLYKKRKWPIHMEHGWAIRAANNTWGELYGACPDVKIRIRDVATEQHFF
VQDTTSYPLILGQPYIMATRMETKVLDDGSAYARRDYGGTKEEVLLQDEGAFDVSFIDIL
ENGNIMYKKVNDFKRKERKRLYNIEGELRKLVTRQKGESDLDNEGDEDKLDKDVENIF
Download sequence
Identical sequences A9SCP7
3218.JGI77592 XP_001764184.1.60028 jgi|Phypa1_1|77592|fgenesh1_pg.scaffold_66000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]