SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI77599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI77599
Domain Number 1 Region: 240-295
Classification Level Classification E-value
Superfamily Homeodomain-like 7.4e-17
Family Myb/SANT domain 0.032
Further Details:      
 
Weak hits

Sequence:  3218.JGI77599
Domain Number - Region: 155-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00586
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI77599
Sequence length 694
Comment (Physcomitrella patens)
Sequence
MDLGDGHPRHGHGKFSFGTHDRSPLVLRRSLPADSPRGPKPVKAHAALRITDASSCPTTC
MPSYPKTNDETKYMNETCQYGCTEKLAGVLNHAVERATAHWVGASSQRNRPRGGLKSRFR
SHAPSGGGRMLVEAGKDSCSKAVKLAALEHIEMSRRCSHCGLNGHNSRTCPDRGVRLFGV
RLTDGISSMNMRKSVSMNNLSHYTSTHNSPSPSEHSESGAAPDGYVSDGLVQTSNNARER
KKGVPWTEDEHRLFLLGLQKLGKGDWRGISRNFVTTRTPTQVASHAQKYFIRQSNMNKRK
RRSSLFDIVSTSGGGVVVMIGWSQSVGMRVEVGWDMIRDVGREWNGMVVGGGTCDLRWGG
LWSMAGRSFDCGRVDMHGRRGADEPTAPVELGAEPHVPVGGVVRAKFGGGIRSIGGRIRG
AEAHESSGDGNGRGWGDGGGGDGVQGGAFGEEWNGGGGDELRHGEEWNGERGCGRGGSSR
GGSVAGRVSGSRKDPVLVHVVGWRRGGFGVDGAGAGSGAGTAGIEQQRRGVIRSEPGDRE
TDGEGGRCEQRSDEDGGGWSGHSAAEAGAVTAGAISVDGKAVGGAVEAFISVPREHVVRW
EQHTTRSERDQRGVKRQRWISYILVSVQNSYPIYRCFEVLHVGLHNCLLCSHSVLQNRYL
SHSRIGYYGLAAIGSNEAEHCGHGDESDLSTRLR
Download sequence
Identical sequences A9SCQ4
XP_001764190.1.60028 3218.JGI77599 jgi|Phypa1_1|77599|fgenesh1_pg.scaffold_66000046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]