SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI77601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI77601
Domain Number 1 Region: 261-312
Classification Level Classification E-value
Superfamily Homeodomain-like 9.72e-16
Family Myb/SANT domain 0.032
Further Details:      
 
Weak hits

Sequence:  3218.JGI77601
Domain Number - Region: 136-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI77601
Sequence length 657
Comment (Physcomitrella patens)
Sequence
MSSDRWFHATGGNISVSRRIKHFPPPPPTLRLVVRFARCRRVTSSRSKAQEKDWVVMRIG
SRRILGKSVGFRFQRVDFWSSTRWFERAGGVEGGIGTNSVEAQGGTEHCGDKGEFDQVVG
FASVLEIEALEEHEMSRRCSHCNLNGHNSRTCSDRGVRLFGVRLTDSVSSMNMRKSVSMN
NLSHYTSAHNPPSPPEHSESGAAPDGYVSDGLVQTSNNARERKKAFLCASFRKIIHLGQK
CSQVKRRVQTHGNIPNHSVGVPWTEDEHRLFLLGLQKLGKGDWRGISRNFVTTRTPTQVA
SHAQKYFIRQSNMNKRKRRSSLFDIVSTSGGGVVVMIGWSQSVGMRVEVGWDMIRDVGRE
WNGMVVGGGTCDLRWGGLWSMAGRSFDCGRVDMHGRRGADEPTAPVELGAEPHVPVGGVV
RAKFGGGIRSIGGRIRGAEAHESSDGVTVDVGGKRDGNGRGWGDGGGGDGVQGGAFGEEW
NGGGGDELRHGEEWNGERGCGRGGSSRGGSVAGRVSGSRKDPVLVHVVGWRRGGFGVDGA
GAGSGAGTAGIEQQRRGVIRSEPGDRETDGEGGRCEQRSDEDGGGWSGHSAAEAGAVTAG
AISVDGKAVGGAVEAFISVPREHVVRWEQHTTRSERDQRGVKRQRCDDGAKCVALSK
Download sequence
Identical sequences A9SCQ6
XP_001764191.1.60028 jgi|Phypa1_1|77601|fgenesh1_pg.scaffold_66000048 3218.JGI77601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]