SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI77949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI77949
Domain Number - Region: 209-248
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0259
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI77949
Sequence length 844
Comment (Physcomitrella patens)
Sequence
MVELFGLATIPEIRDHITSITDRYRNSWEVFSHALKDEYFVEDADRVTKKLFLEWIEQPN
KNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAVDGELQEKLELLLEDNEEDEGL
TTKWKNFEDAVGLLTKKERRKDRSNIPKTVQAPKAPVRTTPPTMPTVQPSTSLSKKADIG
MEEIIRGMRDLQIKLARLEENTSTNNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIR
QGIICWKDGKIALKNREDLLQTNFGKGGMRALVQDYLKEHETTARESASYGARVDDEIGG
SWEDHVESLSVHAYIAKSQHEALMEEKRRENFDDTREGNSSKRQTRGDKAREATSQELPV
KDTSASLGEKTKETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLEIAK
KEFHDVIIDSIKRKRQLMGETGMSYAIDARIYKVEEEVDIGYKQPTNEKNGYNQRVRFED
SSNKEMGTLSHYTRKHWARATTEVLVKVEDKEEPIVALGQPYIMATRMETKVLDDGSAYA
RVRSEDGRKAVQFLTVPPNHERNRDRLRQKPLPKIVEGFKDFGEEVLSRDEGTFDASFIG
ILENGNIMYKKVDDFKRKERKRLYDIEGQLRKLENGLEDSLELITSIGLGDNDKIVEIHS
REVYTILESFQAPEVIVETRYKTTDKKVKPVVGSLSEDSKEQMGEASKEANLRDPMSIGH
QFTKETFEELKIGSDGSLLPEEITYFKKMLAKQGRSFAFESHEIGYLEYWEQRPTAVQIL
SGQVQSSRYSQPRHTEMLHLIPITGVSRKRKDQFTRRGTLFSVNGSLKDKNGGESFDGES
QFRI
Download sequence
Identical sequences A9SDM2
XP_001764422.1.60028 jgi|Phypa1_1|77949|fgenesh1_pg.scaffold_68000082 3218.JGI77949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]