SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI78308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI78308
Domain Number 1 Region: 130-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000586
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Weak hits

Sequence:  3218.JGI78308
Domain Number - Region: 182-205
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0989
Family Virus ectodomain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI78308
Sequence length 251
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTVAASLACTKVWEECHYDQLLMVGTIMIPSIGNQVPMTNMMIGSYPRMIAL
SMENPNSQGVVNATPLQAIPPVATYPSPMAYRQREVPMNATINDSNEALLLNLTKKMEEL
AVHMTKDKEKRHKPSNMRPNIWCNNCKGHGHFDTECPSPHQKMGQCMYYGGKHNTANCWY
LPRQQTMIQPTVWNVNQVQTRNTGRWNGNRNNRVNRGFGNFQNPNYNQPYGTNMQNGGQN
QMGNQPSMPIQ
Download sequence
Identical sequences A9SEJ0
XP_001764726.1.60028 jgi|Phypa1_1|78308|fgenesh1_pg.scaffold_70000125 3218.JGI78308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]