SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI79346
Domain Number 1 Region: 319-361
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000481
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79346
Sequence length 447
Comment (Physcomitrella patens)
Sequence
MHNHDTATATTNFGCDELRIPRPSLTRSSSAFVNFDDDDGTSSPRGIRSLAVCQGPSLHC
LTIYRTGDSSSLIVKSVKRFVKKRIFTKEFGSLFQGALLPNKFKQLELPAEVLSSPVEEI
IKDIERITESETITLPILPPIVLLPMASGGVPSVPTGPPVPPIGLIGPAVPISVPMGQVG
DRTTIALSLVRAKVWEECHYDRILNSNPTLIPTQGSSKFPNWSNLANSITGAMAPATHST
VPIQGVLNPVPLQAVPSPMASTYPQFAPYQPPGVNTQELPMLPGSKETNETLLLNLTKKM
EELAVNMEKEKEKRSKQTNFRANVWCTNCKGQGHMVQDCPSPGNMKIQCMNCGGKHPTNN
CWYLSNPHFNNTMSPSMSWDVQIQSSQEDTNPVLQDSPVNHIEVVQAVQTRGQRNLQSIL
KKDKIIEEQPEPIQKKATIFAKPANQL
Download sequence
Identical sequences A9SH37
XP_001765693.1.60028 jgi|Phypa1_1|79346|fgenesh1_pg.scaffold_78000056 3218.JGI79346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]