SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79498 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI79498
Domain Number - Region: 200-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79498
Sequence length 861
Comment (Physcomitrella patens)
Sequence
MENENKNFEGSLVGVSVGGSSKGQGMHMDPSIASLFQAFSLSMQQQQSNDRKEALATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVELFRLAMIPEIRDHIISITDRYG
NSWEIFSHALKDEYFLEDVDYVTKKLFLGWIERPNKNLQATQLLREKADMGMEEIIRGMR
DLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMMRQEIICWKDG
KIALKDREDLLQTNFGKGGMRALVQDHLKEGKTTARESASYGARVDDDLGGSTETSEFWA
SAVFTMQEGKLPREALLRTAPRIRGATGWKDPVESLSIHAYIAKSQHEALMEEKRRGNFD
DTREGNSFKRQSRRDKAQEATSQELPVKDTSASLEEKTTETKDKGKSIAYKLLSDIEAAS
NLKGMLEERILNAKVEFTLKEVLRIAKKEFHDVIIDSIKRKRQLMDETGMSHAINVRIYK
DEEEVDIGYKQSTNKKNGYNQRVRFKDYSDKEMETLSHYTRKHWTRATTKVLVKVGDIEE
PIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDVLDDGSAYT
RVRSEDGRKAVQFLTVPLNHERNRDRLKEKPLSKIIEGFKDFKELGTLQDDERILGVYEE
NGLEDSLELITSIGLGDNDKIVEIHSREVYTILESFQAPEVTVETRYKMADKKVKPVARP
LPEDSKEQMGEASKEASLRDPMSIGHQFTKETFEELKIGSDGSLLPKEITCFKKMLAKQG
RLFAFESHEIGYLEYWKQRPIPMQILGGQVQSLRYSQSWHTEMLHSIPITGVSKKGKDQF
NDRLFHPLCHFRNILLVKRSL
Download sequence
Identical sequences A9SHI5
jgi|Phypa1_1|79498|fgenesh1_pg.scaffold_79000096 3218.JGI79498 XP_001765850.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]