SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79736 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI79736
Domain Number - Region: 496-592
Classification Level Classification E-value
Superfamily Acid proteases 0.00225
Family Retroviral protease (retropepsin) 0.041
Further Details:      
 
Domain Number - Region: 180-208
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0733
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79736
Sequence length 818
Comment (Physcomitrella patens)
Sequence
MWSRLWGSILFQAVLFSVPFQGTLFSVNGFLKGKNGGESLTARANFGSKLEVEKLTLEPN
KVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTV
QAPKAPVRTTPPTMPTVQPSTSLSKKADMNMEEIIRGMQDLQIKLARLEENTSINNSKNV
SKQGYVQSCIWCDDASHTRKDCNEFNNMIRQGIICWKDEKIALKDREDLLQTNFGKGGMR
ALVQDYLKEYETVVRESASYGARVDDEIGGSTENRKLPREALLRTAATIRGRTGWEDPVE
SLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASL
GEKTMETKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVI
IDSIKRKRQLMSETGMSHTIDARICRDEEEVDIGYKQPTNEKNGYNQRVHFEDSSDKEIE
TLSHYTRKHWARTTTEVLVKVGDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWA
IRAANNTRGELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYIKATRMETKVLDD
GSAYARVRSEDGRKAVQFLTILPNHEWNRDRLREKPLPKIVEGFKDFGEEEVLSRDEGAF
DASFIGILENGNIMYKKVDDFKRKERKRLYDIEGQLRKIENGLEDSLELIISIGLGDNDK
IVEIHSREVYTMLESFQAPEVTIETRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRD
PMSIGHQFTEEALEELKIGSDGSLLPEEITCFKKMLAK
Download sequence
Identical sequences A9SIA4
jgi|Phypa1_1|79736|fgenesh1_pg.scaffold_81000054 XP_001766097.1.60028 3218.JGI79736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]