SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79808 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI79808
Domain Number - Region: 230-262
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000105
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79808
Sequence length 277
Comment (Physcomitrella patens)
Sequence
MVIKNENLTAKKIKQSKERTKRLQARNLLHNERDHKLKKKHRQSWVKLWLHACRHIRSYS
EDDRPLIFQKYILLKKLPIALIGSIANSPAYLSKPLTESEEGTEELARAKVWEECHYDQF
LAIGATMIPSQAGYLIPIWSETRNNYPRMLDYGANLSVNSQRAVNAIPLQNIPPTSVVSY
FPYFPYQKVVPAKELSSQTGPKDLIEPLLITLTMKMEELTVNLAKDKEKRHKPPNMHPNI
RCSNCKGQGHLVTKCPSRPQMTIQCTFCVGKHITTNC
Download sequence
Identical sequences A9SI36
jgi|Phypa1_1|79808|fgenesh1_pg.scaffold_81000126 3218.JGI79808 XP_001766059.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]