SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI79819
Domain Number - Region: 327-366
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 140-234
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0235
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 83-148
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0239
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79819
Sequence length 491
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPFQGTLFSVNGFFKGFLGEVSGGESSKGQGMHLDPSIASLFQ
AFSLSMQQQQNNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMV
ALFGLATIPEIRDHITSITDRCRNSWEDFSHALKDEYFLEDVDRVTKKLFLGWIEWPNKN
LQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEHLLEDKEEDEGLTT
KWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKALVRTTPPTMPTVQPSTSLSKKADMGME
ELIRGMRDLQIKLARLEENTFINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQG
IICWKDGKIALKDKEDLLQTNFRKGGMRALVQDYLKGHETVVRESASYGARVDDEIGGST
EISEFWASAVSTMQEGKLPREELLRTAATIRGRTGWEDPVESLSVHAYILLSRTQNTDLK
SNKKFKKKWQN
Download sequence
Identical sequences A9SI47
XP_001766066.1.60028 jgi|Phypa1_1|79819|fgenesh1_pg.scaffold_81000137 3218.JGI79819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]