SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI79826
Domain Number - Region: 279-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0131
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 34-98
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0432
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79826
Sequence length 411
Comment (Physcomitrella patens)
Sequence
MDPSIASLFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDHFDGRNISRYLRCYVREME
LNRVSEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYLLEDADRVTRKLF
LGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLE
DKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKQVQAPKAPVRTTPPTMPTVQPSTS
LSKKTDMGMEEIIRGMRDLQIKLARLEENTSINNSKNVLKQGYVQRCIWCDDASHTRKDC
NEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKGHETVARESASYGA
RVDDEIGGSTETKMNMEDLNEGTEIPQQEDESDMDNEGDEDELDKDVGDIF
Download sequence
Identical sequences A9SI53
XP_001766072.1.60028 jgi|Phypa1_1|79826|fgenesh1_pg.scaffold_81000144 3218.JGI79826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]