SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI79864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI79864
Domain Number - Region: 105-129
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00215
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI79864
Sequence length 186
Comment (Physcomitrella patens)
Sequence
MQIYDDISMHIQNIMDMTIFLADLGYTVLDKMITLKIIYTLPPSFNSIIATWSNVLKNEQ
TVDHLDERLLRHESLLQRQGGRPTKFITKKKQQQQDINYMYDLKAQTKCYNCHEMGYWSA
DYTKPRKKRLHSKDPRNVDGGMKDANMAESLSTSNALDNDSHFGSDNNYAFVVNTYLYSY
YMLLNP
Download sequence
Identical sequences A9SIH2
jgi|Phypa1_1|79864|fgenesh1_pg.scaffold_82000031 3218.JGI79864 XP_001766184.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]