SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI80323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI80323
Domain Number - Region: 46-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0154
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI80323
Sequence length 417
Comment (Physcomitrella patens)
Sequence
MPTVQPLTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRHGIICWNDGKIALKNREDLLQTNFGKGRMRALVQDYLKEHETV
ARESASYGARVDDEIGGSTETSEFWASAVFTMQEGKLPREALLRTAATIRGQPYITATRM
ETKVLDDGSAYARRDYRGIKEEVLLRDKGAFDASFIGILENGNIMYKKVDDFKRKERKIL
YNIEGQLHKIGTLQDDERILGVYEENGLEDSLDLITSIGLGDNDKIVEIHSREVYTMLES
FQAPEVTVETRYKMADKKVKLVAGPLQEHSKEQMGEASKEASLRDPMSIGHQFTEETFEE
LKIGSDGSLLPEEITCFKKMLAKQGRSSKYYNTYGYLHCTTCTLESKTDSRTDDIFT
Download sequence
Identical sequences A9SJN0
XP_001766539.1.60028 jgi|Phypa1_1|80323|fgenesh1_pg.scaffold_85000062 3218.JGI80323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]